When I hover over a marker there's a text blub that pops up in the source monitor. The color is dark blue and it's difficut to see what the text says against some footage.
Is there a way to change the color to something lighter?
How do I add Marker Title to be visible on the Markers panel? Seems like this should be trivial, but I don't see a quick way to do this.
View 4 Replies View RelatedIn CS6, is it possible to navigate between clip markers in the timeline.
I'm talking about markers placed on actual clips, not markers placed on the sequence timeline.
I'd like to have a shortcut to navigate between clip markers but that shortcut seems to only work on markers placed on the sequences timeline, not on the clip.
Yes, you can open the clip in the source monitor, then jump to clip markers for that one clip but that's not what I'm after.
I want to mark my clips in the source monitor, bring all those clips to one timeline, then navigate between the markers placed on the actual clip.
Is it possible to prevent timeline markers from responding to a ripple delete? On a film project it's not an issue, but when I do broadcast work, a lot of times I need to hit specfic moments in time, like 28:30 for a half hour show. I'll add a timeline comment mark to that point in time, but later, due to a lot or ripple deleting, that marker has shifted drastically. Right now the only work around I found is to add an ajustment later on an unused track and lock the track. But this gets to be a pain if I need multiple markers.
View 2 Replies View RelatedIf I add markers to a source clip and enter a name, then when I open the Markers panel, I only see Comments listed, not Names?
View 4 Replies View Relatedwhat I meant is I have a title in white and want to change it a few seconds into the clip to another color. obviously I could replicate the title and using the titler color the fonts with whatever color I wanted, but is there a simpler, quicker way to do the change in color within this same clip , perhaps using keyframes?
View 10 Replies View RelatedI'm doing subtitles for a documentary, and find myself wanting to change the font style in many clips at times. I know, I could start with a prefect template and copy that one over sequences, but in practice I find that you end up changing your mind mid-way about the specifics.
Coming from FCP, I remember there was a way to do this via an XML readout of the sequence (doing a "find and replace" query). Is there anything similar in PP? Or maybe even easier? An extension?
Anything that let me avoid clicking on hundreds of clips to change the style individually.
I need to change the default text color to a pantone spot color.
View 5 Replies View RelatedNow, with that task simplified, I'm not sure how to change the color of the text created using this tool.
View 1 Replies View RelatedIs there a way to change the marker style on general note labels that are already in the drawing without having to select them all and change it in the properties? I want to change the marker style from "basic" to "none" on the note labels but I'm not seeing a ToolSpace setting to change them all at the same time without having to individually change it...
View 8 Replies View RelatedI want to navigate along my feature line, viewing which point is screen is the current point at the grid.
My feature line shows its points with blue circle & square grips and the current point is showed by a green circle.
The problem is the zoom level, Grips have always the same size but circular green indicator does not.
You can only view this last at a very detailed zoom.
I'd like to have a "big" arrow or something similar.The problem is the great difficulty to identify points....
Civil 3D (2013)
I was wondering if there's any way to manipulate text to look like it was written in real life by a marker or a sharpie - both in writing and in color that will fit the lighting in the image.
View 2 Replies View Relatede.g. 25,00mm instead of 25.00mm.
I have a huge list of drawings I need to apply this update to. Updating Styles isn't really an option as we haven't enough consistency in the styles we have used.
Inventor 2013 Certified Professional
Autodesk Inventor Professional 2011
Windows 7 Enterprise, 64-bit
I have been sent a text logo in EPS format that I want to change to JPG or GIF. I need to change the text color. How do I do this please? I can change the format - it is changing the text color that is my problem.
View 1 Replies View RelatedI am using Photoshop elements 6.0, and I have a layered .psd file that is driving me crazy.
It's a black & white photo that I want to add colored text over the top,
but for some reason the text is only being displayed in gray-scale. Code:
If there was a better way to handle changing the color of text or object as it goes over an underlying object.
Please see the attached file for an example and details of how I did it.
All I want to do is place white text (oh, one colored word) on a black background. I can't find a tool to make that happen.
View 3 Replies View RelatedI'm using Illustrator 6 on Windows with the latest SDK.My plugin changes the colors of paths and text.I have a single word of text specified as a spot color, it comes though in the code as a kTextFrameArt...I am using the following code to change the text color, but it has no effect,
//textArt is a AIArtHandle
ATE::TextRangeRef textRangeRef;
AIErr err = sAITextFrame->GetATETextRange( textArt, &textRangeRef );
if ( err == kNoErr ) {
}
[code]....
Is is possible to have an attributed block in a marker style or note style? I would like to have editable text upon insertion of the marker or text? I have tried unsuccessfully to get it to work. Does the fact that C3D displays the marker and note as objects prevent it from being editable? Is there a workaround?
View 1 Replies View RelatedI have white text on a yellow background...I need to change the background to white and the text to green. The rasterized text is part of the yellow background (ie it's not a seperate layer). Any attempt to change the colour or select the text invariably doesn't catch all the aliased pixels....with my resulting text not looking as smooth as the original.
View 9 Replies View RelatedIs there a way to change the color of the dimension text?
I wanted to have the color of the dimension text different from the dimension line but couldn’t find where such option might be found.
I need to write some text in continuation in different color. I am not getting a way to change the color of some part of the text.
View 3 Replies View RelatedI attached some old PDF drawings and they are just perfect. The background is transparent and they really look pretty good. Is it possible to change the color of the pdf text?
Version: AutoCAD C3D 2010
I need it in 3 different colors, and 3 different fonts. So far when I try it doesn't work.
I can do the first word in one layer and open up a second layer for the next few words, but as soon as I start typing the second word, the first one becomes the color of the second word.
I have a large (22"x28") poster completely filled with 8 pt text. I have a simple image under the text. I want to change the parts of the text over the image to the image color. Basically, I want to make the image out of the tiny text and delete the image from the background. As of right now, I'm individually selecting text and changing the color, bit by bit. I know there has to be a much better way, this is going to take hours! I've been using AI for a very long time and this is one of the only times I've been completely stumped! I've included a sample image, the actual one is much more involved.
View 10 Replies View RelatedUsing Photoshop CC on a Mac running the newest versions of everything and I am having trouble getting the eyedropper to work properly. I have a text layer selected and I've always been able to switch to the eyedropper and change the color of the text directly.
I chatted with Adobe support and they got me to delete my preferences folder. It worked after that the next time I opened Photoshop but then the next time, stopped working again. Delete preferences folder again and it works but after the first try it stops working every time.
My experience with Photoshop is self-taught. I use Photoshop 7 and am currently using a trial version of Photoshop Elements 12. I found an image of a rounded corner rectangle. I changed the background color to a shade of red (R102 B8 G0), and then created the word BLOG in white. The original image size is 487 x 487 pixels and looks great. When I resize the image to the icon size I want (30 x 30 pixels or 25 x 25 pixels), the red background color bleeds through parts of the text and just doesn’t look as good. What do I need to do to resolve?
View 1 Replies View RelatedI have a large text with different letters and want to change the different letters with different color. for an example
RTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHAPRRTKIFIRF
PKTLFATEDSLEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHAPRRTKIFIRFPKTLFATE
DALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHEPRRTKIFIRFPKTLFATEDALEIRR
QSLATKIQATWRGFHCRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIQGFILRHAPRRTKIFIRFPKTLFATEDSLEVRRQSLATKI
QAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHSPR
How do I select all the text and change the same letters to a selected color at once, I know how to change the color for a letter one by one, but it is too tedious.
In a project I'm working on I need to make the text have mirror properties. But when editing the text all i can choose from is "normal" colors.
So is there any way to make text use materials, like you do on normal surfaces?
I have created my own graphics from scratch with GIMP, but the resolution to this issue is eluding me.
I imported a GIF map and want to add red labels. I have no problem adding the labels, but I cannot seem to get the text colored red. Before I create the text layer, the text tool shows the color is red, but it still creates it black. All of the suggestions I've seen (yes, I've read the fine manual) reference the same things, including dragging the color from the foreground color (which I've also changed to red). Nothing I've tried seems to work. I've even saved the image as an XCF, but I have the same problem.
How to globally change text color to by layer in autocad 2008.
View 9 Replies View Related