i need to manipulate the text of a field in cdr file(For example:- from 'yogesh' to 'sharma') using c# code....
i know it is something like...
CorelDRAW.Application cdr =
new Application();
cdr.OpenDocument(@"C:UsersuserDesktop500074.cdr", 1);
this will open the cdr file but how should i manipulate text of its fields...
I have designed a C# application to To Print I Cards Of School. Here I am sending data from my application to a CDR FILE (Already Created ) Which Contains ADDRESS Text Field..Now I Need to Print Address(which contains 60 characters or more) on this Text field .
I Have Used The following c# Code.. To Replace Address text field that contains text 'Address '.....
s.Text.Replace('Address',"Text To be replaced .......")...here s is Active shape...
This Works Fine But How can i WRAP TEXT....of Address field.
The new light blue color looks nice but on my project with 20% cyan scattered everywhere. When it's the background you are not even sure you have anything selected without going to wireframe.
View 4 Replies View Related1. Is there an area in 3ds where I can enter comments about what I'm doing? When I save a new version, unless I document in a separate file, there's no way to know what changes I made.
2. The Scene Explorer seems to stay open when I re-open a file.
But the Layers window doesn't. Is there a way to force it to open with a file also?
I'm perfectly happy with the TrueType font (BankGothic Md BT), but all the style settings change to the T1 equivalent every time I close, and when I open the file again the T1 text does not show up. I can go through and reset all the styles, then re-apply them, but it wastes a lot of time.
View 1 Replies View RelatedI am using a symbol that includes a several text boxes. Each text box includes "prompted text" and "drawing properties". When I insert the symbol onto a drawing, the "Edit Property Fields" menu appears. In this menu, I can input my prompted field text or see the various "drawing properties".
My question is, how do I change the order that these property fields are displayed? It seems as if it depends on the order that the text boxes were created while defining the symbol definition. Is there any other way to change the display order?
how to convert a frame into an empty text frame using a macro?
View 1 Replies View RelatedI am having an issue with X6's print merge not recognizing a properly formatted numeric filed from my Excel spreadsheet. My first issue was that Corel was adding a decimal point after my numbers. This was when they were still formatted as text fields. (which i still don't understand why, since they were just TEXT fileds)
I know that the fields need to be "numeric" fields.
FYI i have ALREADY COMPLETED MY TASK by using an "added" numeric filed that i added IN CorelDraw and then used the "Numeric Field Options" at the bottom of the page to get my number sequence.
However, that is not my question.... my question is: How do i get corel to RECOGNIZE a numeric field AS a numeric field in the first place.
Why cant I save a cdr job with all the merge fields setup so that next time I open the file I can go straight to 'merge to new document'.
So Ive set up a 10 to view raffle tickets job. Inserted 20 numerical merge fields, positioned, resized, applied font size color alignment etc etc etc.. Takes ages..... So then merge to a new document, works nice and I can save it fine.
There are a hundred reasons why i may have to close the 'master' merge file before the job has been successfully printed. It may be a repeat print job.
Any which way I really dont get why the live merge data fields are lost on closing the file.
Our company does not have the funds to upgrade so we are stuck with CD12. I am using using a windows 7 /64 bit machine. I created this xml template for the writers to place place their graphics in our author software.
I have 4 layers on my file - grid.guide,desktop and template. The template has the instructions and size dimensions. I have them put all graphics on the high lited desktop layer then when this is complete turn off the template layer. One can print this file with just the graphics showing with no problem.
However if I export this a PNG file both the template and desktop layers show up even though I turned off all layers. I just want the desktop layer with the graphics to show up. I have been using Adobe Illustrator for several years and this doesn't present a problem when saving the graphic as a PNG file.
we updated from corel 14 with smart designer to corel 15 with smart designer 4.5. Corel is crashing almost continually and is running slow. it is on a dell workstation running a xeon processor W 3503 @2.4 GHZ with 4 gig of RAM with windows 7 professional with service pack 1 32 bit system. We have defraged the system, ran a registry cleaner, rebooted etc..
View 1 Replies View RelatedI would like to export my Corel files and parse them myself with C# code for display in Microsoft’s WPF. I've tried this with SVG files with mixed success. Any resource that explains the coordinate system of Corel's SVG export data?
After parsing corel SVG paths, I've noticed some odd behavior. Here are a few things:
The position of a Corel graphic on a page prior to exportation affects the size of the graphic in the SVG file?
I get negative numbers (x y points) in the SVG file when corel numbers are all pos. The x,y values seem to be flipped to y,x values.
I have a large volume of our own clip art that I need to put on line via Microsoft's WPF (windows presentation foundation) all of which is saved in CDR files .
I want to add image file to a cdr file using c# code.
View 4 Replies View RelatedIs it possible to create a field that will show only a portion of the contents within an text object? Maybe using diesel or something?
Example:
There is a text object that contains "FIRST TEST", is it possible to create a field from that object that contains the first 5 letters of the text "FIRST". If the original text was changed to "SECOND TEST" the field would be updated "SECON"
I've created an input text inside a symbol called "Asks" in a timeline triger i use:
message = sym.$("texto"); // texto is a textfield
message.html("Write here: ");
inputMessage = $('<textarea />').attr({'type':'textarea','value':'', 'id':'message'});
inputMessage .css ('font-size', 18);
inputMessage .css ('box-shadow', '#0a81fb');
[Code] ......
I´m trying to extract text from a Corel file to a TXT file in another editor and then merge it back in.Extracting the text seems to be working just fine but when I´m trying to merge it back in I get the error message "Wrong file format or could not open".
View 2 Replies View RelatedIf I type some text, then select the 'Selector Tool', then use the middle 'bounds handles' to resize.I would expect the text to be stretched.But, what I get is resizing in both horizontal and vertical directions. As if I was using the corner 'bounds handles'.
It works as I would expect in Designer Pro X.Is there a setting I've missed somewhere?
Is there a way to edit the Welcome/Quick Start screen?
I would like to make this:
Look more like this:
except with better artwork. Is this possible? What files do I need to change?
I am using CorelDraw 12. I am trying to automate the Art work generation process using the Interop.CorelDraw Assembly along with C# .Net. I am facing a problem. When I am creating a word object, if the Height of the Text is greater than 21cms the art work is not being generated. It took me a while to understand this. I am not really sure how to remove the size range for the Text.
View 1 Replies View RelatedI exported a swf file to my computer, which i made with Xara designer 10. I would like to re-edit the file but don't know how to open it again in Xara.How do I do that?
View 7 Replies View RelatedIf I'm working in any orthographical view (Front, Top, etc.) and I'm switching to perspective, field of view is not 45 degree and it randomly changes.
Is there any "cure" for this?
I'm using a lot's of field in my plan and i want like to know if it's possible to change de color grey of the field box? Without color would be best for me!
View 4 Replies View RelatedWhat way can i read text from a text field on stage then put this value into a variable?
I can easily write text to a text field via:
sym.$("my_text_field").html("Some text...");
But I want to read this text into a vairable? For example:
var theText = my_text_field.text
I have a large text with different letters and want to change the different letters with different color. for an example
RTKIFIRFPKTLFATEDALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHAPRRTKIFIRF
PKTLFATEDSLEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHAPRRTKIFIRFPKTLFATE
DALEVRRQSLATKIQAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHEPRRTKIFIRFPKTLFATEDALEIRR
QSLATKIQATWRGFHCRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIQGFILRHAPRRTKIFIRFPKTLFATEDSLEVRRQSLATKI
QAAWRGFHWRQKFLRVKRSAICIQSWWRGTLGRRKAAKRKWAAQTIRRLIRGFILRHSPR
How do I select all the text and change the same letters to a selected color at once, I know how to change the color for a letter one by one, but it is too tedious.
I am new to CorelDRAW. I am using it to generate scientific application notes that contain both graphics and text. I am running into a problem where I have a negative number that is close to the end of a text line (using justified format). CorelDRAW wants to treat the negative like a hyphen and keep the "-" on one line and then moves the number to the next line. For example, if the phrase "...cooling to -150 C for 5 minutes..." were to wrap across a line, it would look like:
"...cooling to -
150 C for 5 minutes..."
Instead of:
"...cooling to
-150 C for 5 minutes..."
The only way I can figure out how to get past it is to change the width of the text box so the lines wrap in different places. I have tried adding a space or two, adding hidden text (text with the same color as the background).
I want to select my text and change the size from my macro. As of now if i preselect the size it outputs the size once i type the text in box and add to page, but i cannot change the size by selecting the text. Im building this off of my output settings.
Sub ChangeSize ()Dim OriginalSelection as S,
text as StringDim txtShape as ShapeOn Error Resume NextOriginalSelection = (ComboFontSize.text, "pt", "")size = CInt(text)Set textShape = ActiveLayer.CreateArtisticText(ActiveLayer.Page.CenterX, 8, FontText.text,
cdrLanguageNone,
cdrCharSetMixed, Me.lstFonts.text, size)
End Sub
I'm putting the finishing touches on a painting I've been working on using PSE4 and Xara Pro 7, and I've run into a problem: Xara won't open the image. The image is in TIFF. The error code I get is this: 0ee3d87d-4061-4c60-ad08-89d82ea87ffc. I've been able to open previous versions of the image in Xara. This image has a lot more detail, so I wonder if file size is this issue?
View 5 Replies View RelatedI've had this problem with XDP6 and now I have it with XDP7 as well.
If I am opining a file (double-click on it to open) and I don't have all the fonts that may have been used in the file, then I get a message telling me so, but, I cannot click on the 'Continue' button to do so.
Designer is simply frozen, no matter how long I wait. I can click on all sorts of things but nothing happens.
I have to CTRL+ALT+DELETE to shut down Designer.
If I have Designer open already, then sometimes I can click on 'Continue' but not always.
I am trying to figure out if it is possible to change the iProperties default field names. For example, in iProperties, under the Project tab, i want to change the field "Stock Number" to "Drawing Number". I know that i could create my own custom field in a seperate tab, but i think this way would have a much cleaner look and simpler workflow. If it is possible, is it something that i can incorporate into an ipt template? Or will this only change on my system?
I am working in Inventor 2012 Pro
Is there a key I can press that will change my cursor from the pointer to the text writing tool?
View 3 Replies View RelatedI know I can use the shortcut Shift F3 to bring up the Change Case Menu.
Is there a way to just highlight the text and press a shortcut or macro to change directly to UpperCase?
